HPA026531

RPS6KC1 antibody from Sigma-Aldrich
humS6PKh1, RSKL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026531
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026531, RRID:AB_10601497
Product name
Anti-RPS6KC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026531
Antibody type
Polyclonal
Antigen
ribosomal protein S6 kinase, 52kDa, polypeptide 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPNMVCLHKYIISEESVFLVLQHAEGGKLWSYISK
FLNRSPEESFDIKEVKKPTLAKVHLQQPTSSPQDS
SSFESRGSDGGSMLKALPLKSSLTPSSQDD
Storage
-20C
Provider Type Product Number
- No reagents -