HPA029023

antibody from Atlas Antibodies

Targeting: SMYD2 HSKM-B, KMT3C, ZMYND14

Antibody data

Submit

Validation data

Product number: HPA029023 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029023, RRID:AB_10601605
Product name: Anti-SMYD2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYS KHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGS AIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIK P
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SMYD2 protein structure - HPA029023 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using HPA029023 antibody. Corresponding SMYD2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human uterine cervix shows moderate to strong nuclear positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows weak nuclear positivity in glandular cells.
Sample type: HUMAN