HPA024372

S100A8 antibody from Atlas Antibodies
60B8AG, CAGA, CFAG, CGLA, MRP8, P8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024372
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024372, RRID:AB_1856536
Product name
Anti-S100A8
Provider product page
Atlas Antibodies - HPA024372
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKK
LLETECPQYIRKKGADVWFKELDINTDGAVNFQEF
LILVIKM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -