HPA024372

S100A8 antibody from Sigma-Aldrich
60B8AG, CAGA, CFAG, CGLA, MRP8, P8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024372
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024372, RRID:AB_1856536
Product name
Anti-S100A8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024372
Antibody type
Polyclonal
Antigen
Protein S100-A8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKK
LLETECPQYIRKKGADVWFKELDINTDGAVNFQEF
LILVIKM
Storage
-20C
Provider Type Product Number
- No reagents -