HPA020593

EPHX1 antibody from Sigma-Aldrich
EPHX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020593
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020593, RRID:AB_10601373
Product name
Anti-EPHX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020593
Antibody type
Polyclonal
Antigen
epoxide hydrolase 1, microsomal (xenobiotic) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETS
DEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLK
KVISYWRNEFDWKKQVEILNRHPHFKTKIEGLDIH
FI
Storage
-20C
Provider Type Product Number
- No reagents -