AV40784

TMEM63A antibody from MilliporeSigma / Merck KGaA
KIAA0792
No application information provided.

Antibody data

Product number
AV40784
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV40784, RRID:AB_1858126
Product name
Anti-TMEM63A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV40784
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human TMEM63A with an internal ID of Y01036
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSA
KNSTVLQGVTFGGIP
Storage
-20C
Provider Type Product Number
- No reagents -