Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003707-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003707-M01, RRID:AB_509103
- Product name
- ITPKB monoclonal antibody (M01), clone 2F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ITPKB.
- Antigen sequence
PELLPQDQDKPFLRKACSPSNIPAVIITDMGTQED
GALEETQGSPRGNLPLRKLSSSSASSTGFSSSYED
SEEDISSDPERTLDPNSAFLHTLDQQKPR- Isotype
- IgG
- Antibody clone number
- 2F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human inositol 1,4,5-trisphosphate 3-kinase isoform B (IP3KB) is a nucleocytoplasmic shuttling protein specifically enriched at cortical actin filaments and at invaginations of the nuclear envelope.
Nalaskowski MM, Fliegert R, Ernst O, Brehm MA, Fanick W, Windhorst S, Lin H, Giehler S, Hein J, Lin YN, Mayr GW
The Journal of biological chemistry 2011 Feb 11;286(6):4500-10
The Journal of biological chemistry 2011 Feb 11;286(6):4500-10
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ITPKB monoclonal antibody (M01), clone 2F8 Western Blot analysis of ITPKB expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ITPKB expression in transfected 293T cell line by ITPKB monoclonal antibody (M01), clone 2F8.Lane 1: ITPKB transfected lysate(67.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ITPKB is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol