Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002987-M02A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002987-M02A, RRID:AB_1016806
- Product name
- GUK1 monoclonal antibody (M02A), clone 1H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GUK1.
- Antigen sequence
LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRL
RQRNTETEESLVKRLAAAQADMESSKEPGLFDVVI
INDSLDQAYAELKEALSEEIKKAQRTGA- Isotype
- IgM
- Antibody clone number
- 1H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GUK1 expression in transfected 293T cell line by GUK1 monoclonal antibody (M02A), clone 1H3.Lane 1: GUK1 transfected lysate (Predicted MW: 21.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of GUK1 transfected lysate using anti-GUK1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GUK1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol