Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055746-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055746-M01, RRID:AB_566032
- Product name
- NUP133 monoclonal antibody (M01), clone 3E8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NUP133.
- Antigen sequence
LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVK
ILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNP
YFEFVLKANYEYYVQGQ- Isotype
- IgG
- Antibody clone number
- 3E8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Nuclear distributions of NUP62 and NUP214 suggest architectural diversity and spatial patterning among nuclear pore complexes.
Alterations in nuclear pore architecture allow cancer cell entry into or exit from drug-resistant dormancy.
[Multiple lymphoepithelial cysts of the parotid gland. Case report].
Kinoshita Y, Kalir T, Dottino P, Kohtz DS
PloS one 2012;7(4):e36137
PloS one 2012;7(4):e36137
Alterations in nuclear pore architecture allow cancer cell entry into or exit from drug-resistant dormancy.
Kinoshita Y, Kalir T, Rahaman J, Dottino P, Kohtz DS
The American journal of pathology 2012 Jan;180(1):375-89
The American journal of pathology 2012 Jan;180(1):375-89
[Multiple lymphoepithelial cysts of the parotid gland. Case report].
Dubiel-Bigaj M, Papla B, Lenik J
Patologia polska 1989;40(3):360-4
Patologia polska 1989;40(3):360-4
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NUP133 monoclonal antibody (M01), clone 3E8 Western Blot analysis of NUP133 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NUP133 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to NUP133 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol