Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA060059 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-GNPAT
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LEERRHVSDLKFAMKCYTPLVYKGITPCKPIDIKC
SVLNSEEIHYVIKQLSKESLQSVDVLREEVSEILD
EMSHKLRLGAIRFCAFTLSKVFKQIFSKVCVNEEG
IQKLQRAIQEHPVVLLPSHRSYIDFLMLSFLLYNY
DLP- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Common and Differential Traits of the Membrane Lipidome of Colon Cancer Cell Lines and their Secreted Vesicles: Impact on Studies Using Cell Lines.
Bestard-Escalas J, Maimó-Barceló A, Lopez DH, Reigada R, Guardiola-Serrano F, Ramos-Vivas J, Hornemann T, Okazaki T, Barceló-Coblijn G
Cancers 2020 May 20;12(5)
Cancers 2020 May 20;12(5)
No comments: Submit comment
No validations: Submit validation data