H00007257-M02A

TSNAX antibody from Abnova Corporation
C3PO, TRAX
No application information provided.

Antibody data

Product number
H00007257-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007257-M02A, RRID:AB_1205122
Product name
TSNAX monoclonal antibody (M02A), clone 4D5
Provider product page
Abnova Corporation - H00007257-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TSNAX.
Antigen sequence
VADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVY
DGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYAL
KVRGSEIPKHMLADVFSVKTEMIDQEEGIS
Isotype
IgM
Antibody clone number
4D5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -