HPA031054

TSNAX antibody from MilliporeSigma / Merck KGaA
C3PO, TRAX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031054
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031054, RRID:AB_10600415
Product name
Anti-TSNAX antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031054
Antibody type
Polyclonal
Antigen
translin-associated factor X recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYD
GFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALK
VRGSEIPKHMLADVFSVK
Storage
-20C
Provider Type Product Number
- No reagents -