HPA026825

NPFFR2 antibody from Sigma-Aldrich
GPR74, NPFF2, NPGPR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026825
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026825, RRID:AB_10603123
Product name
Anti-NPFFR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026825
Antibody type
Polyclonal
Antigen
neuropeptide FF receptor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYYRVRLNSQNKTSPVYWCREDWPNQEMRK
Storage
-20C
Provider Type Product Number
- No reagents -