HPA028125

NTPCR antibody from Sigma-Aldrich
C1orf57, HCR-NTPase, MGC13186, THEP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028125
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028125, RRID:AB_10601091
Product name
Anti-C1orf57 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028125
Antibody type
Polyclonal
Antigen
Nucleoside-triphosphatase C1orf57 (NTPase) (EC 3.6.1.15) (Nucleoside triphosphate phosphohydrolase) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVR
QTLSTPGTIILGTIPVPKGKPLALVEEIRN
Storage
-20C
Provider Type Product Number
- No reagents -