HPA000561

CCDC120 antibody from Sigma-Aldrich
JM11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000561
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000561, RRID:AB_2244190
Product name
Anti-CCDC120 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000561
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 120 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QADALRRLHELEEQLRDVRARLGLPVLPLPQPLPL
STGSVITTQGVCLGMRLAQLSQEDVVLHSESSSLS
ESGASHDNEEPHGCFSLAERPSPPKAWDQLR
Storage
-20C
Provider Type Product Number
- No reagents -