HPA025770

FH antibody from Sigma-Aldrich
fumarase
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025770
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025770, RRID:AB_10599603
Product name
Anti-FH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025770
Antibody type
Polyclonal
Antigen
fumarate hydratase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DASVSFTENCVVGIQANTERINKLMNESLMLVTAL
NPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTA
EQFDEWVKPK
Storage
-20C
Provider Type Product Number
- No reagents -