Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00440738-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00440738-B01, RRID:AB_1137742
- Product name
- MAP1LC3C MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human MAP1LC3C protein.
- Antigen sequence
MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPN
KIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFL
SIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIY
RDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLE
DRPCNPL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The carboxyl-terminal amino acids render pro-human LC3B migration similar to lipidated LC3B in SDS-PAGE.
Wang W, Chen Z, Billiar TR, Stang MT, Gao W
PloS one 2013;8(9):e74222
PloS one 2013;8(9):e74222
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MAP1LC3C expression in transfected 293T cell line (H00440738-T01) by MAP1LC3C MaxPab polyclonal antibody.Lane 1: MAP1LC3C transfected lysate(16.17 KDa).Lane 2: Non-transfected lysate.