Antibody data

Product number
H00440738-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00440738-B01, RRID:AB_1137742
Product name
MAP1LC3C MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00440738-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MAP1LC3C protein.
Antigen sequence
MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPN
KIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFL
SIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIY
RDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLE
DRPCNPL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -