HPA028389

PLD5 antibody from Sigma-Aldrich
FLJ40773
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028389
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028389, RRID:AB_10602145
Product name
Anti-PLD5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028389
Antibody type
Polyclonal
Antigen
phospholipase D family, member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DWVGNDFTQNAGTGLVINQADVRNNRSIIKQLKDV
FERDWYSPYAKTLQPTKQPNCSSLFKLKPLSNKTA
TDDTGGKDPRNV
Storage
-20C
Provider Type Product Number
- No reagents -