H00010472-M04

ZBTB18 antibody from Abnova Corporation
C2H2-171, RP58, TAZ-1, ZNF238

Antibody data

Product number
H00010472-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010472-M04, RRID:AB_1205199
Product name
ZNF238 monoclonal antibody (M04), clone 4E4
Provider product page
Abnova Corporation - H00010472-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF238.
Antigen sequence
KRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATA
AGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDL
SVKSSLSGVENLNSSYFSSQDVLRSNLVQV
Isotype
IgG
Antibody clone number
4E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -