SAB2100760

COX20 antibody from MilliporeSigma / Merck KGaA
FAM36A, FLJ43269
No application information provided.

Antibody data

Product number
SAB2100760
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-FAM36A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2100760
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_932342.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTH
LDPERKHNGSSSN
Storage
-20C