H00064754-B01

SMYD3 antibody from Abnova Corporation
KMT3E, ZMYND1, ZNFN3A1

Antibody data

Product number
H00064754-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064754-B01, RRID:AB_11189242
Product name
SMYD3 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00064754-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SMYD3 protein.
Antigen sequence
MRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCK
PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDL
ESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQ
LPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYP
SISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEE
LTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQ
DKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQ
VLAMCQAIISSNSERLPDINIYQLKVLDCAMDACI
NLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVM
KVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHS
LIEDLILLLEECDANIRAS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -