H00006285-M03

S100B antibody from Abnova Corporation
S100beta

Antibody data

Product number
H00006285-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006285-M03, RRID:AB_1580335
Product name
S100B monoclonal antibody (M03), clone 1B2
Provider product page
Abnova Corporation - H00006285-M03
Antibody type
Monoclonal
Antigen
S100B (NP_006263, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
Mouse monoclonal antibody raised against a partial recombinant S100B.
Reactivity
Human
Host
Mouse
Antigen sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKE
LINNELSHFLEEIKEQEVVDKVMETLDNDGDGECD
FQEFMAFVAMVTTACHEFFEHE
Isotype
IgG
Vial size
100 μg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -