HPA015768

S100B antibody from Sigma-Aldrich
S100beta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015768
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015768, RRID:AB_1856538
Product name
Anti-S100B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015768
Antibody type
Polyclonal
Antigen
Protein S100-B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEKAMVALIDVFHQYSGREGDKHKLKKSELKELIN
NELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQE
FMAFVAMVTTACHEFFEHE
Storage
-20C
Provider Type Product Number
- No reagents -