HPA016697

RYR2 antibody from Sigma-Aldrich
ARVC2, ARVD2, VTSIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016697
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016697, RRID:AB_1856527
Product name
Anti-RYR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016697
Antibody type
Polyclonal
Antigen
Ryanodine receptor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FSKTVAGGLPGAGLFGPKNDLEDYDADSDFEVLMK
TAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSR
LKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYD
FLMQTSTYYYSVR
Storage
-20C
Provider Type Product Number
- No reagents -