Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA016697 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-RYR2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FSKTVAGGLPGAGLFGPKNDLEDYDADSDFEVLMK
TAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSR
LKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYD
FLMQTSTYYYSVR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Junctophilin-2 in the nanoscale organisation and functional signalling of ryanodine receptor clusters in cardiomyocytes
Reduced junctional Na+/Ca2+-exchanger activity contributes to sarcoplasmic reticulum Ca2+ leak in junctophilin-2-deficient mice
Munro M, Jayasinghe I, Wang Q, Quick A, Wang W, Baddeley D, Wehrens X, Soeller C
Journal of Cell Science 2016;129(23):4388-4398
Journal of Cell Science 2016;129(23):4388-4398
Reduced junctional Na+/Ca2+-exchanger activity contributes to sarcoplasmic reticulum Ca2+ leak in junctophilin-2-deficient mice
Wang W, Landstrom A, Wang Q, Munro M, Beavers D, Ackerman M, Soeller C, Wehrens X
American Journal of Physiology-Heart and Circulatory Physiology 2014;307(9):H1317-H1326
American Journal of Physiology-Heart and Circulatory Physiology 2014;307(9):H1317-H1326
No comments: Submit comment
No validations: Submit validation data