AV33540

APOBEC3G antibody from MilliporeSigma / Merck KGaA
bK150C2.7, CEM15, dJ494G10.1, FLJ12740, MDS019
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV33540
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV33540, RRID:AB_1844939
Product name
Anti-APOBEC3G antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV33540
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human APOBEC3G with an internal ID of P04591
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMAT
FLAEDPKVTLTIFVA
Storage
-20C
Provider Type Product Number
- No reagents -