HPA001812

APOBEC3G antibody from Sigma-Aldrich
bK150C2.7, CEM15, dJ494G10.1, FLJ12740, MDS019
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001812
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001812, RRID:AB_1078175
Product name
Anti-APOBEC3G antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001812
Antibody type
Polyclonal
Antigen
DNA dC->dU-editing enzyme APOBEC-3G recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELC
FLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMA
KFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEA
GAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDE
HSQDLSGRL
Storage
-20C
Provider Type Product Number
- No reagents -