Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00200316-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00200316-A01, RRID:AB_535119
- Product name
- APOBEC3F polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant APOBEC3F.
- Antigen sequence
YTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYY
FWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENF
VYNDDEPFKPWKGLKYNFLFLDSKLQEIL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel HIV-1 restriction factor that is biologically distinct from APOBEC3 cytidine deaminases in a human T cell line CEM.NKR.
APOBEC3G and APOBEC3F require an endogenous cofactor to block HIV-1 replication.
Zhou T, Han Y, Dang Y, Wang X, Zheng YH
Retrovirology 2009 Apr 3;6:31
Retrovirology 2009 Apr 3;6:31
APOBEC3G and APOBEC3F require an endogenous cofactor to block HIV-1 replication.
Han Y, Wang X, Dang Y, Zheng YH
PLoS pathogens 2008 Jul 4;4(7):e1000095
PLoS pathogens 2008 Jul 4;4(7):e1000095
No comments: Submit comment
No validations: Submit validation data