HPA004334

ARPC1A antibody from Atlas Antibodies
Arc40, SOP2Hs, SOP2L
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA004334
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004334, RRID:AB_887611
Product name
Anti-ARPC1A
Provider product page
Atlas Antibodies - HPA004334
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTL
KTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDR
GCLTFVSKLDIPKQSIQRNMSAMERFRNMDKRATT
EDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTG
I
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -