Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004334 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004334, RRID:AB_1078215
- Product name
- Anti-ARPC1A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTL
KTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDR
GCLTFVSKLDIPKQSIQRNMSAMERFRNMDKRATT
EDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTG
I- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Isoform diversity in the Arp2/3 complex determines actin filament dynamics
Abella J, Galloni C, Pernier J, Barry D, Kjær S, Carlier M, Way M
Nature Cell Biology 2015 December;18(1):76-86
Nature Cell Biology 2015 December;18(1):76-86
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ARPC1A antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line MCF-7.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & cell junctions.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
- Sample type
- HUMAN