HPA004334

ARPC1A antibody from Sigma-Aldrich
Arc40, SOP2Hs, SOP2L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004334
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004334, RRID:AB_1078215
Product name
Anti-ARPC1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004334
Antibody type
Polyclonal
Antigen
Actin-related protein 2/3 complex subunit 1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTL
KTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDR
GCLTFVSKLDIPKQSIQRNMSAMERFRNMDKRATT
EDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTG
I
Storage
-20C
Provider Type Product Number
- No reagents -