HPA021226

COX19 antibody from Atlas Antibodies

MGC104475

Immunocytochemistry: Supportive data in Antibodypedia

Immunohistochemistry: Enhanced validation

Provider product page for HPA021226

Antibody data

Antibody Data
References [0]
Comments [0]
Validations
Immunocytochemistry [1]
Immunohistochemistry [6]

Submit

Validation data

Product number: HPA021226
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021226, RRID:AB_1847176
Product name: Anti-COX19
Provider product page: Atlas Antibodies - HPA021226
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKC LHNNNFENALCRKESKEYLECRMERKLMLQEPLEK LGFGD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and liver tissues using HPA021226 antibody. Corresponding COX19 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more