HPA021226

COX19 antibody from Sigma-Aldrich
MGC104475
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021226
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021226, RRID:AB_1847176
Product name
Anti-COX19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021226
Antibody type
Polyclonal
Antigen
Cytochrome c oxidase assembly protein COX19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKC
LHNNNFENALCRKESKEYLECRMERKLMLQEPLEK
LGFGD
Storage
-20C
Provider Type Product Number
- No reagents -