H00005940-M01

RBMY1A1 antibody from Abnova Corporation
RBM1, RBM2, YRRM1, YRRM2

Antibody data

Product number
H00005940-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005940-M01, RRID:AB_1579634
Product name
RBMY1A1 monoclonal antibody (M01), clone 3G1
Provider product page
Abnova Corporation - H00005940-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RBMY1A1.
Antigen sequence
YGTSHGAPPARGPRMSYGGSTCHAYSNTRDRYGRS
WESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPD
PREACGSSSYVASIVDGGESRSEKGDSSRY
Isotype
IgG
Antibody clone number
3G1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -