HPA001374

RADX antibody from Atlas Antibodies
CXorf57, FLJ10178, FLJ14191

Antibody data

Product number
HPA001374
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001374, RRID:AB_2666288
Product name
Anti-CXorf57
Provider product page
Atlas Antibodies - HPA001374
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KQVKPEWRLPKLNHRFTTRSELDDMPENCICDVIG
LLVFVGRVQRSKKKENREDFWSYRWIHIADGTSEQ
PFIVELFSTSQPEIFENIYPMAYFVCTQLKVVRND
NQVPKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.