HPA003421

MICAL3 antibody from Sigma-Aldrich
KIAA0819
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003421
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003421, RRID:AB_10601134
Product name
Anti-MICAL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003421
Antibody type
Polyclonal
Antigen
microtubule associated monoxygenase, calponin and LIM domain containing 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YAYDIEDGKFYCKPHYCYRLSGYAQRKRPAVAPLS
GKEAKGPLQDGATTDANGRANAVASSTERTPGSGV
NGLEEPSIAKRLRGTPERIELENYRLSLRQAEALQ
EVPEETQAEHNLSSVLDTGAEEDVASRSARRA
Storage
-20C
Provider Type Product Number
- No reagents -