Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310058 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RNA Binding Motif Protein 14 (RBM14) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RBM14 antibody: synthetic peptide directed towards the N terminal of human RBM14
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELST
KGQKK GPGLAVQSGD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Gene amplification and associated loss of 5' regulatory sequences of CoAA in human cancers.
Sui Y, Yang Z, Xiong S, Zhang L, Blanchard KL, Peiper SC, Dynan WS, Tuan D, Ko L
Oncogene 2007 Feb 8;26(6):822-35
Oncogene 2007 Feb 8;26(6):822-35
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting