HPA006628

RBM14 antibody from Sigma-Aldrich
COAA, DKFZp779J0927, SIP, SYTIP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006628
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006628, RRID:AB_1078546
Product name
Anti-RBM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006628
Antibody type
Polyclonal
Antigen
RNA-binding protein 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAG
QPSAAYLSMSQGAVANANSTPPPYERTRLSPPRAS
YDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQL
SFRRSPTKSSLDYRRLPDAHSDYAR
Storage
-20C
Provider Type Product Number
- No reagents -