HPA002736

CFAP57 antibody from Sigma-Aldrich
FLJ32000, WDR65
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002736
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002736, RRID:AB_2272982
Product name
Anti-WDR65 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002736
Antibody type
Polyclonal
Antigen
WD repeat protein 65 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PESNLVYWLWEKQKVMAIVRIDTQNNPVYQVSFSP
QDNTQVCVTGNGMFKLLRFAEGTLKQTSFQRGEPQ
NYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETS
IMVKEPTNGSKSLDVIQESESLIEFPPVSSPLP
Storage
-20C
Provider Type Product Number
- No reagents -