HPA007216

CRCP antibody from Sigma-Aldrich
CGRP-RCP, RCP, RCP9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007216
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007216, RRID:AB_1856160
Product name
Anti-CRCP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007216
Antibody type
Polyclonal
Antigen
DNA-directed RNA polymerase III subunit RPC9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHR
PVTAVEIQLMVEESEERLTEEQIEALLHTVTSILP
AEPEAEQKKNTNSNVAMDEEDPA
Storage
-20C
Provider Type Product Number
- No reagents -