H00080761-B01P

UPK3B antibody from Abnova Corporation
FLJ32198, MGC10902, p35, UPIIIb

Antibody data

Product number
H00080761-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00080761-B01P, RRID:AB_1581732
Product name
UPK3B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00080761-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human UPK3B protein.
Antigen sequence
MGLPWGQPHLGLQMLLLALNCLRPSLSLGEWGSWM
DASSQTQGAGGPAGVIGPWAPAPLRLGEAAPGTPT
PVSVAHLLSPVATELVPYTPQITAWDLEGKVTATT
FSLEQPRCVFDGLASASDTVWLVVAFSNASRGFQN
PETLADIPASPQLLTDGHYMTLPLSPDQLPCGDPM
AGSGGAPVLRVGHDHGCHQQPFCNAPLPGPGPYRE
DPRIHRHLARAAKWQHDRHYLHPLFSGRPPTLGLL
GSLYHALLQPVVAGGGPGAAADRLLHGQALHDPPH
PTQRGRHTAGGLQAWPGPPPQPQPLAWPLCMGLGE
MGRRE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -