HPA010506

UPK3B antibody from Atlas Antibodies
FLJ32198, MGC10902, p35, UPIIIb
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010506
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010506, RRID:AB_889070
Product name
Anti-UPK3B
Provider product page
Atlas Antibodies - HPA010506
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGL
ASASDTVWLVVA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -