HPA010506

UPK3B antibody from Sigma-Aldrich
FLJ32198, MGC10902, p35, UPIIIb
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010506
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010506, RRID:AB_1080479
Product name
Anti-UPK3B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010506
Antibody type
Polyclonal
Antigen
Uroplakin-3B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGL
ASASDTVWLVVA
Storage
-20C
Provider Type Product Number
- No reagents -