HPA026307

antibody from Atlas Antibodies

Targeting: CAMK2B CAM2, CAMK2, CAMKB, CaMKIIβ

Antibody data

Submit

Validation data

Product number: HPA026307 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA026307, RRID:AB_1845941
Product name: Anti-CAMK2B
Antibody type: Polyclonal
Reactivity: Human, Mouse
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLL NKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQ TTVIH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CAMK2B protein structure - HPA026307 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and placenta tissues using HPA026307 antibody. Corresponding CAMK2B RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse olfactory bulb shows positivity in neuronal cell bodies and processes in anterior olfactory nucleus.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows positivity in a subset of neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse forebrain shows positivity in cell bodies and processes of neurons in ventral pallidum and piriform cortex.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse somatosensory cortex shows immunoreactivity in neuronal cells bodies and dendrites.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse cerebellum shows positivity in neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse medulla shows immunoreactivity in the inferior olivary nucleus and raphe obscures nucleus.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate immunoreactivity in neuropil and cytoplasmic positivity in neuronal cell bodies.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows positivity in Purkinje cells as well as in molecular and granular cell layers

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart shows weak to moderate cytoplasmic positivity in cardiomyocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse brain shows moderate to strong positivity in more than 75 % of neurons in the cerebral cortex.
Sample type: MOUSE