HPA026307

CAMK2B antibody from Sigma-Aldrich
CAM2, CAMK2, CAMKB, CaMKII?
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026307
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026307, RRID:AB_1845941
Product name
Anti-CAMK2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026307
Antibody type
Polyclonal
Antigen
Calcium/calmodulin-dependent protein kinase type II beta chain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLL
NKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQ
TTVIH
Storage
-20C
Provider Type Product Number
- No reagents -