HPA021590

CDRT4 antibody from Sigma-Aldrich
FLJ36674
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021590
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021590, RRID:AB_1848906
Product name
Anti-CDRT4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021590
Antibody type
Polyclonal
Antigen
CMT1A duplicated region transcript 4 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDARRMKKEEGLTENTGLPRKLLEKHDPWPAYVTY
TSQTVKRLIEKSKTRELECMRALEERPWASRQNKP
SSVI
Storage
-20C
Provider Type Product Number
- No reagents -