HPA003440

KB-1839H6.1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003440
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003440, RRID:AB_1078348
Product name
Anti-CHCHD10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003440
Antibody type
Polyclonal
Antigen
Coiled-coil-helix-coiled-coil-helix domain-containing protein 10 Precursor (Protein N27C7-4)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGS
SEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDC
STTQSDLSLCEGFSEALKQCKYYHGLSSLP
Storage
-20C
Provider Type Product Number
- No reagents -