Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00050484-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00050484-M01, RRID:AB_566150
- Product name
- RRM2B monoclonal antibody (M01), clone 6C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RRM2B.
- Antigen sequence
DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRK
SSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLS
KDLPHWNKLKAD- Isotype
- IgG
- Antibody clone number
- 6C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ribonucleotide reductase small subunit p53R2 suppresses MEK-ERK activity by binding to ERK kinase 2.
Piao C, Jin M, Kim HB, Lee SM, Amatya PN, Hyun JW, Chang IY, You HJ
Oncogene 2009 May 28;28(21):2173-84
Oncogene 2009 May 28;28(21):2173-84
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RRM2B on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol