HPA019765

GET4 antibody from Sigma-Aldrich
C7orf20, CEE, CGI-20, H_NH1244M04.5, TRC35
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019765
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019765, RRID:AB_1845750
Product name
Anti-C7orf20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019765
Antibody type
Polyclonal
Antigen
UPF0363 protein C7orf20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIG
QLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGE
ESPSDGSPIELD
Storage
-20C
Provider Type Product Number
- No reagents -