HPA022905

SEPTIN4 antibody from Atlas Antibodies
ARTS, C17orf47, CE5B3, FLJ40121, H5, hCDCREL-2, hucep-7, MART, PNUTL2, SEPT4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022905
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022905, RRID:AB_1856687
Product name
Anti-SEPT4
Provider product page
Atlas Antibodies - HPA022905
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLV
VKERNRNKLTRESGTDFPIPAVPPGTDPETEKLIR
EKDEELRRMQE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -