HPA022905

antibody from Atlas Antibodies

Targeting: SEPTIN4 ARTS, C17orf47, CE5B3, FLJ40121, H5, hCDCREL-2, hucep-7, MART, PNUTL2, SEPT4

Antibody data

Submit

Validation data

Product number: HPA022905 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA022905, RRID:AB_1856687
Product name: Anti-SEPT4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLV VKERNRNKLTRESGTDFPIPAVPPGTDPETEKLIR EKDEELRRMQE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SEPTIN4 protein structure - HPA022905 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA022905 antibody. Corresponding SEPT4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells and cells in molecular layer.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in spermatids.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Sample type: HUMAN