HPA006312

ISY1 antibody from Sigma-Aldrich
fSAP33, KIAA1160
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006312
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006312, RRID:AB_1079734
Product name
Anti-ISY1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006312
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKVKERRPFLASECTELPKAEKWRRQIIGEISKKV
AQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIK
ELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAK
DLPGVRELFEKEPLPPPRK
Storage
-20C
Provider Type Product Number
- No reagents -